2.85 Rating by CuteStat

It is a domain having site extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, appliancefix.site is SAFE to browse.

PageSpeed Score
71
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.248.233.180

Hosted Country:

United States of America US

Location Latitude:

40.793

Location Longitude:

-74.0247

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: 1
Total IFRAMEs: Not Applicable Total Images: 29
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.248.233.180)

Rathfarnham Appliance Repairs | Boiler Repairs | Dublin

- rathfarnhamappliances.site

Rathfarnham Appliance Repairs specialise in all domestic appliance repairs based in Dublin. Call us today.

Not Applicable $ 8.95

Walmsley appliance repair services | kitchen appliance repairs | Showe

- walmsleyapplianceservices.site

Welcome to Walmsley Appliance Services. All brands of electrical home appliances repaired Tel: 098 28814 For appliance repairs and shower repairs accross Mayo

Not Applicable $ 8.95

Electrical Retailer Tiverton

- clarkeselectrical.site
Not Applicable $ 8.95

Auto Repair Tucson | Mechanic Arizona | Car Repair 85751- Milex Auto S

- milexauto.site

Milex Auto Repair Services offers a multitude of services to keep your car in the best possible condition. Call us and schedule an appointment today!

Not Applicable $ 8.95

The Beauty and A Beet

- thebeautyandabeet.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Fri, 28 Sep 2018 22:33:35 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Last-Modified: Thu, 27 Sep 2018 21:52:09 GMT
ETag: W/"e654-576e159bf9440"
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
appliancefix.site A 3592 IP: 104.248.233.180
appliancefix.site NS 1800 Target: ns3.digitalocean.com
appliancefix.site NS 1800 Target: ns1.digitalocean.com
appliancefix.site NS 1800 Target: ns2.digitalocean.com
appliancefix.site SOA 1800 MNAME: ns1.digitalocean.com
RNAME: hostmaster.appliancefix.site
Serial: 1538098193
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 1800